DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and CG13748

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster


Alignment Length:51 Identity:15/51 - (29%)
Similarity:25/51 - (49%) Gaps:2/51 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEPFVQGSCLELTDLYSYVEYKNDCVYWQ--GCLLNGNHFSKKEECEDMCK 72
            |.|..:|.|..|...:.|...:..||.::  ||..|.|:|:..::|...|:
  Fly    61 LMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 14/48 (29%)
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 15/51 (29%)

Return to query results.
Submit another query.