DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and CG2816

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster


Alignment Length:51 Identity:19/51 - (37%)
Similarity:25/51 - (49%) Gaps:2/51 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEPFVQGSCLELTDLYSYVEYKNDC--VYWQGCLLNGNHFSKKEECEDMCK 72
            |:|.:.|.|....:.|:|...|..|  ..:.||..|.|.||.|.|||..|:
  Fly    32 LQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCR 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 18/48 (38%)
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 18/48 (38%)

Return to query results.
Submit another query.