DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and CG10031

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster


Alignment Length:50 Identity:13/50 - (26%)
Similarity:23/50 - (46%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEPFVQGSCLELTDLYSYVEYKNDCVYWQ--GCLLNGNHFSKKEECEDMC 71
            |:|...|.|....:.:.|.:....|..::  ||..|.|.:..::.||:.|
  Fly    76 LQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 12/48 (25%)
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 12/48 (25%)

Return to query results.
Submit another query.