DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and CG3604

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster


Alignment Length:50 Identity:19/50 - (38%)
Similarity:23/50 - (46%) Gaps:4/50 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPFVQGSCLELTDLYSYVEYKNDC---VYWQGCLLNGNHFSKKEECEDMC 71
            :|...|.|..|...|:|......|   || .||..|.|:|..||:||..|
  Fly    57 QPKETGRCFALFYRYAYNVDTQSCEEFVY-GGCAGNKNNFESKEQCEQAC 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 18/48 (38%)
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 18/48 (38%)

Return to query results.
Submit another query.