DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and CG16704

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster


Alignment Length:73 Identity:26/73 - (35%)
Similarity:39/73 - (53%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VYILIWTILALT-ADINGLVCNLEPFVQGSCLELTDLYSYVEYKNDC--VYWQGCLLNGNHFSKK 64
            |:.||..::|.. |.:...:|..|..|:|:|..|..:::|....|:|  ..:.||..|.|.|.||
  Fly     6 VFALICCLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKK 70

  Fly    65 EECEDMCK 72
            .|||:.||
  Fly    71 LECEEKCK 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 19/51 (37%)
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 17/44 (39%)

Return to query results.
Submit another query.