DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and Acp24A4

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:76 Identity:25/76 - (32%)
Similarity:38/76 - (50%) Gaps:5/76 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVYILIWTILALTAD---INGLVCNLEPFVQGSCLELTDLYSYVEYKNDC--VYWQGCLLNGNH 60
            ||:.||::..:||.::   :...:|.|.....|:||.|...:||....|.|  ..:.||..|.|.
  Fly     1 MKLLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENS 65

  Fly    61 FSKKEECEDMC 71
            |..:|||.:.|
  Fly    66 FESQEECINKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 18/51 (35%)
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 18/50 (36%)

Return to query results.
Submit another query.