DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and Tfpi2

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_001368837.1 Gene:Tfpi2 / 21789 MGIID:108543 Length:266 Species:Mus musculus


Alignment Length:72 Identity:22/72 - (30%)
Similarity:33/72 - (45%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILIWTILALT---ADINGLVCNLEPFVQGSCLELTDLYSYVEYKNDC--VYWQGCLLNGNHFSKK 64
            :|:.::|.||   |..|.|...|.|...|.|..|...:.|...:..|  ..:.|||.|.|:|..:
Mouse    51 LLVGSVLGLTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSR 115

  Fly    65 EECEDMC 71
            :.|:..|
Mouse   116 DLCQQTC 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 14/51 (27%)
Tfpi2NP_001368837.1 Kunitz_TFPI2_1-like 68..124 CDD:438659 16/55 (29%)
Kunitz-type 129..182 CDD:444694
Kunitz_TFPI1_TFPI2_3-like 189..242 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.