DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and Col28a1

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_001032954.1 Gene:Col28a1 / 213945 MGIID:2685312 Length:1141 Species:Mus musculus


Alignment Length:49 Identity:15/49 - (30%)
Similarity:23/49 - (46%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPFVQGSCLELTDLYSYVEYKNDCV-YW-QGCLLNGNHFSKKEECEDMC 71
            |....|.|.:....:.|.:..|.|. :| .||..:||.|..::||.:.|
Mouse  1090 EALKPGECGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECRETC 1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 14/47 (30%)
Col28a1NP_001032954.1 vWFA_subfamily_ECM 47..212 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..770
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
gly_rich_SclB <525..>773 CDD:468478
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.