DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and W05B2.2

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_499406.2 Gene:W05B2.2 / 189208 WormBaseID:WBGene00012271 Length:1278 Species:Caenorhabditis elegans


Alignment Length:72 Identity:20/72 - (27%)
Similarity:26/72 - (36%) Gaps:16/72 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TADINGLVCNLEPFVQGSCL------------ELTDLYSYVEYKNDC--VYWQGCLLNGNHFSKK 64
            |.|....||..:|  ..:||            |....::|....|.|  |....||...|.|...
 Worm   385 THDCKNTVCCPKP--AATCLQQLRTRDNCEQGETVTKWTYSTEHNMCKSVLASRCLKGDNQFDSI 447

  Fly    65 EECEDMC 71
            |||:.:|
 Worm   448 EECQSVC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 17/63 (27%)
W05B2.2NP_499406.2 EB 67..118 CDD:460294
Kunitz_conkunitzin 191..247 CDD:438636
KU 305..355 CDD:197529
Kunitz_conkunitzin 508..560 CDD:438636
KU 613..665 CDD:197529
Lustrin_cystein 719..764 CDD:464222
EB 1210..1262 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.