DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42495 and Tmem42

DIOPT Version :9

Sequence 1:NP_001163464.1 Gene:CG42495 / 8674004 FlyBaseID:FBgn0260027 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001178815.1 Gene:Tmem42 / 363171 RGDID:1307118 Length:157 Species:Rattus norvegicus


Alignment Length:114 Identity:33/114 - (28%)
Similarity:51/114 - (44%) Gaps:17/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVAGSFAAAGSFFGKLPSHLSAQKLLNTSQINEDFSYLEIALLQLLPLVLMVTCNVCNLRFFLKA 75
            :.||:|.|..:         :|.||...||:|       |.|. :|.::.|.:.|.....||.:.
  Rat    44 MCAGAFGALAA---------AAAKLAFGSQVN-------IGLC-VLGIIAMASTNSLMWTFFSRG 91

  Fly    76 LQMTEQTLTCVVLTAASNYVLSFVLGALVYREPLTVLSGIGITLILAGL 124
            |..:..:....|....||.:.|.:||.::|.|...:|...|:.|||.||
  Rat    92 LSFSMSSAIASVTVTFSNILCSAILGYVLYGECQEILWWGGVFLILCGL 140



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007500
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105090
Panther 1 1.100 - - LDO PTHR31965
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.