Sequence 1: | NP_001163464.1 | Gene: | CG42495 / 8674004 | FlyBaseID: | FBgn0260027 | Length: | 142 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496387.2 | Gene: | F40F8.3 / 185540 | WormBaseID: | WBGene00009576 | Length: | 146 | Species: | Caenorhabditis elegans |
Alignment Length: | 131 | Identity: | 27/131 - (20%) |
---|---|---|---|
Similarity: | 58/131 - (44%) | Gaps: | 22/131 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 VAGSFAAAGSFFGKLPSHLSAQKLLNTSQINEDFSYLEIALLQLLPLVLMVTCNVCNLRFFLKAL 76
Fly 77 QMTEQTLTCVVLTAASNYVLSFVLGALVYREPLTVLSGIGITLILAGLWFLCDGGTVESEKQDKM 141
Fly 142 E 142 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160165667 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2E1X2 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007500 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_105090 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR31965 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.830 |