DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42495 and F40F8.3

DIOPT Version :9

Sequence 1:NP_001163464.1 Gene:CG42495 / 8674004 FlyBaseID:FBgn0260027 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_496387.2 Gene:F40F8.3 / 185540 WormBaseID:WBGene00009576 Length:146 Species:Caenorhabditis elegans


Alignment Length:131 Identity:27/131 - (20%)
Similarity:58/131 - (44%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VAGSFAAAGSFFGKLPSHLSAQKLLNTSQINEDFSYLEIALLQLLPLVLMVTCNVCNLRFFLKAL 76
            |||...:.|:..|||......::....|.:                 .:.:..|:.....:.:||
 Worm    37 VAGMCGSMGAVSGKLAFDWDLEQYARCSCV-----------------AVFIGSNIVMWATYTRAL 84

  Fly    77 QMTEQTLTCVVLTAASNYVLSFVLGALVYREPLTVLSGIGITLILAGLWFLCDGGTVESEKQDKM 141
            .:::.|.|.:::..|.|:.|:.:||:|::.|..:.|..:.:.:::.||..|     :.|:.:|..
 Worm    85 ALSDCTSTPMIINMACNFALTGILGSLIFSESHSYLWWLLLIMLITGLTML-----LSSKHEDLK 144

  Fly   142 E 142
            |
 Worm   145 E 145



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165667
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E1X2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007500
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105090
Panther 1 1.100 - - LDO PTHR31965
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.