| Sequence 1: | NP_001163464.1 | Gene: | CG42495 / 8674004 | FlyBaseID: | FBgn0260027 | Length: | 142 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_003200553.1 | Gene: | LOC100537949 / 100537949 | -ID: | - | Length: | 154 | Species: | Danio rerio |
| Alignment Length: | 133 | Identity: | 41/133 - (30%) |
|---|---|---|---|
| Similarity: | 57/133 - (42%) | Gaps: | 15/133 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 YSLVAGSFAAAGSFFGKL---PSHLSA-----------QKLLNTSQINEDFSYLEIALLQLLPLV 59
Fly 60 LMVTCNVCNLRFFLKALQMTEQTLTCVVLTAASNYVLSFVLGALVYREPLTVLSGIGITLILAGL 124
Fly 125 WFL 127 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 54 | 1.000 | Inparanoid score | I5445 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0007500 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_105090 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR31965 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 5.050 | |||||