DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42496 and COX19

DIOPT Version :9

Sequence 1:NP_001163243.1 Gene:CG42496 / 8674001 FlyBaseID:FBgn0260222 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001026788.1 Gene:COX19 / 90639 HGNCID:28074 Length:90 Species:Homo sapiens


Alignment Length:88 Identity:37/88 - (42%)
Similarity:52/88 - (59%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TSQIYSQKKFVPTPPEKGSFPLDHEGLCKKQFLLYASCLRKNAQDTSQCRQDAQNYLACRMDNNL 66
            |:..:..|.|.|.||:||||||||.|.||.....:..||..|..:.:.||::::.||.|||:..|
Human     3 TAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKL 67

  Fly    67 MEKTEWSKLGFHD-QSTKTDQKE 88
            |.:....||||.| .|.|::.|:
Human    68 MLQEPLEKLGFGDLTSGKSEAKK 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42496NP_001163243.1 CHCH 29..63 CDD:284221 11/33 (33%)
COX19NP_001026788.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 6/16 (38%)
CHCH 30..64 CDD:284221 11/33 (33%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 30..40 2/9 (22%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 51..61 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145656
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3477
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5270
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55534
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006556
OrthoInspector 1 1.000 - - oto88311
orthoMCL 1 0.900 - - OOG6_103881
Panther 1 1.100 - - LDO PTHR21107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R243
SonicParanoid 1 1.000 - - X4790
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.