DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42496 and COX19-1

DIOPT Version :9

Sequence 1:NP_001163243.1 Gene:CG42496 / 8674001 FlyBaseID:FBgn0260222 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_564879.1 Gene:COX19-1 / 842977 AraportID:AT1G66590 Length:113 Species:Arabidopsis thaliana


Alignment Length:80 Identity:34/80 - (42%)
Similarity:45/80 - (56%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PTPPEKGSFPLDHEGLCKKQFLLYASCLRKNAQDTSQCRQDAQNYLACRMDNNLMEKTEWSKLGF 77
            |.|||||.|||||...|..:...|..||:.:|..:.|||..::.||.|||..|||.|.:.::|||
plant    30 PIPPEKGIFPLDHLHECDAEKKEYLGCLKSSAHKSEQCRHLSKKYLQCRMAKNLMAKQDMAELGF 94

  Fly    78 H--DQSTKTDQKEPE 90
            .  .:...|:.|..|
plant    95 SGVKELDSTEDKNTE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42496NP_001163243.1 CHCH 29..63 CDD:284221 12/33 (36%)
COX19-1NP_564879.1 CHCH 46..80 CDD:284221 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3477
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I2493
OMA 1 1.010 - - QHG55534
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006556
OrthoInspector 1 1.000 - - oto3641
orthoMCL 1 0.900 - - OOG6_103881
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4790
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.