Sequence 1: | NP_001163243.1 | Gene: | CG42496 / 8674001 | FlyBaseID: | FBgn0260222 | Length: | 94 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_932097.1 | Gene: | Cox19 / 68033 | MGIID: | 1915283 | Length: | 92 | Species: | Mus musculus |
Alignment Length: | 93 | Identity: | 36/93 - (38%) |
---|---|---|---|
Similarity: | 49/93 - (52%) | Gaps: | 4/93 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 TSQIYSQKKFVPTPPEKGSFPLDHEGLCKKQFLLYASCLRKNAQDTSQCRQDAQNYLACRMDNNL 66
Fly 67 MEKTEWSKLGFHDQSTKTDQKEPEVQKQ 94 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42496 | NP_001163243.1 | CHCH | 29..63 | CDD:284221 | 11/33 (33%) |
Cox19 | NP_932097.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | 6/16 (38%) | |
CHCH | 30..64 | CDD:310983 | 11/33 (33%) | ||
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 | 30..40 | 2/9 (22%) | |||
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 | 51..61 | 4/9 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167835722 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3477 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 73 | 1.000 | Inparanoid score | I5276 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG55534 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0006556 | |
OrthoInspector | 1 | 1.000 | - | - | oto91883 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_103881 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR21107 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R243 |
SonicParanoid | 1 | 1.000 | - | - | X4790 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
13 | 12.790 |