DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42496 and Cox19

DIOPT Version :9

Sequence 1:NP_001163243.1 Gene:CG42496 / 8674001 FlyBaseID:FBgn0260222 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001100596.1 Gene:Cox19 / 304330 RGDID:1305631 Length:92 Species:Rattus norvegicus


Alignment Length:91 Identity:36/91 - (39%)
Similarity:49/91 - (53%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TSQIYSQKKFVPTPPEKGSFPLDHEGLCKKQFLLYASCLRKNAQDTSQCRQDAQNYLACRMDNNL 66
            |:..:..|.|.|.||:||||||||.|.||.....:..|||....:.:.||.:::.||.|||...|
  Rat     3 TAMNFGTKSFQPRPPDKGSFPLDHFGECKSFKEKFMKCLRDKNYENALCRNESKEYLMCRMQRQL 67

  Fly    67 MEKTEWSKLGFHDQSTKTDQKEPEVQ 92
            |......||||.|    ..:::||.:
  Rat    68 MAPEPLEKLGFRD----IMEEKPEAK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42496NP_001163243.1 CHCH 29..63 CDD:284221 11/33 (33%)
Cox19NP_001100596.1 CHCH 30..64 CDD:399611 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3477
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5187
OMA 1 1.010 - - QHG55534
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006556
OrthoInspector 1 1.000 - - oto95459
orthoMCL 1 0.900 - - OOG6_103881
Panther 1 1.100 - - LDO PTHR21107
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4790
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.