DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42496 and cox-19

DIOPT Version :9

Sequence 1:NP_001163243.1 Gene:CG42496 / 8674001 FlyBaseID:FBgn0260222 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_492719.1 Gene:cox-19 / 172913 WormBaseID:WBGene00009745 Length:85 Species:Caenorhabditis elegans


Alignment Length:64 Identity:35/64 - (54%)
Similarity:44/64 - (68%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PEKGSFPLDHEGLCKKQFLLYASCLRKNAQDTSQCRQDAQNYLACRMDNNLMEKTEWSKLGFHD 79
            |.||||||||||.||.:.|.|..||.:..|..|:||..|::|..|||::.||:|.||.|||:.|
 Worm    16 PLKGSFPLDHEGTCKLEMLNYMVCLHEKKQQNSECRSTAKDYFECRMNHGLMDKEEWQKLGYGD 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42496NP_001163243.1 CHCH 29..63 CDD:284221 14/33 (42%)
cox-19NP_492719.1 CHCH 29..63 CDD:369061 14/33 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3477
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3771
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55534
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006556
OrthoInspector 1 1.000 - - oto19280
orthoMCL 1 0.900 - - OOG6_103881
Panther 1 1.100 - - LDO PTHR21107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R243
SonicParanoid 1 1.000 - - X4790
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.