DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42496 and cox19

DIOPT Version :9

Sequence 1:NP_001163243.1 Gene:CG42496 / 8674001 FlyBaseID:FBgn0260222 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001104010.1 Gene:cox19 / 100004173 ZFINID:ZDB-GENE-070410-29 Length:93 Species:Danio rerio


Alignment Length:78 Identity:39/78 - (50%)
Similarity:49/78 - (62%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TSQIYSQKKFVPTPPEKGSFPLDHEGLCKKQFLLYASCLRKNAQDTSQCRQDAQNYLACRMDNNL 66
            |:..:..|.|.|.||:||:|||||.|.||....:|..|||.|..|.|:||.:::.||.||||..|
Zfish     3 TAMNFGSKTFRPRPPDKGAFPLDHFGECKSFKEVYMQCLRNNHFDNSRCRIESKEYLECRMDRQL 67

  Fly    67 MEKTEWSKLGFHD 79
            |.|....||||:|
Zfish    68 MTKEPLEKLGFND 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42496NP_001163243.1 CHCH 29..63 CDD:284221 15/33 (45%)
cox19NP_001104010.1 CHCH 30..64 CDD:284221 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579057
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3477
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5163
OMA 1 1.010 - - QHG55534
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006556
OrthoInspector 1 1.000 - - oto40813
orthoMCL 1 0.900 - - OOG6_103881
Panther 1 1.100 - - LDO PTHR21107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R243
SonicParanoid 1 1.000 - - X4790
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.