DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp70A4 and CG42481

DIOPT Version :9

Sequence 1:NP_001163437.1 Gene:Sfp70A4 / 8673995 FlyBaseID:FBgn0259970 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001163438.1 Gene:CG42481 / 8674058 FlyBaseID:FBgn0259971 Length:49 Species:Drosophila melanogaster


Alignment Length:38 Identity:22/38 - (57%)
Similarity:29/38 - (76%) Gaps:2/38 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLNLLLVVLFLIGMVEARRRKREVEIWIRPEK--HNPP 38
            ||..|||:|.|:||..|||:|||||:|:||.:  :|.|
  Fly     4 LLFFLLVILCLVGMAPARRKKREVEVWVRPSQNSYNEP 41



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019511
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.