DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp70A4 and CG42481

DIOPT Version :10

Sequence 1:NP_001163437.1 Gene:Sfp70A4 / 8673995 FlyBaseID:FBgn0259970 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001163438.1 Gene:CG42481 / 8674058 FlyBaseID:FBgn0259971 Length:49 Species:Drosophila melanogaster


Alignment Length:38 Identity:22/38 - (57%)
Similarity:29/38 - (76%) Gaps:2/38 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLNLLLVVLFLIGMVEARRRKREVEIWIRPEK--HNPP 38
            ||..|||:|.|:||..|||:|||||:|:||.:  :|.|
  Fly     4 LLFFLLVILCLVGMAPARRKKREVEVWVRPSQNSYNEP 41

Return to query results.
Submit another query.