powered by:
Protein Alignment Sfp70A4 and CG42481
DIOPT Version :9
Sequence 1: | NP_001163437.1 |
Gene: | Sfp70A4 / 8673995 |
FlyBaseID: | FBgn0259970 |
Length: | 55 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001163438.1 |
Gene: | CG42481 / 8674058 |
FlyBaseID: | FBgn0259971 |
Length: | 49 |
Species: | Drosophila melanogaster |
Alignment Length: | 38 |
Identity: | 22/38 - (57%) |
Similarity: | 29/38 - (76%) |
Gaps: | 2/38 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LLNLLLVVLFLIGMVEARRRKREVEIWIRPEK--HNPP 38
||..|||:|.|:||..|||:|||||:|:||.: :|.|
Fly 4 LLFFLLVILCLVGMAPARRKKREVEVWVRPSQNSYNEP 41
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0019511 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.