DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Ir94d

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster


Alignment Length:185 Identity:36/185 - (19%)
Similarity:67/185 - (36%) Gaps:74/185 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 NSKYRIQLDTYARLGYQARQPLRDMLDCKFKYIF-RDRWSDGNATGGMIGDLILDKADLAIAP-F 276
            :|.:::|.|      |:....|||..|.::.|:. .::||           |:.::..:..:| |
  Fly   425 SSIFQLQED------YKEFLHLRDSFDTRYGYMMPMEKWS-----------LMKEQQRVFSSPLF 472

  Fly   277 IYSFDRALF-----LQPITKFSVFRE--------------ICMFRNPRSVSAGLSATEFLQPFSG 322
            ....|..:|     :.|:.|.|:|:|              :..:|:       :|.||.::....
  Fly   473 SLQDDLCVFHTVPIVFPMVKNSIFKEPFDRLILDVTATGLLSRWRD-------MSFTEMIKAGQL 530

  Fly   323 G--------------------VWLTFALLLLLAGCLLWVTFILE-----RRKQWK 352
            |                    :|.....:|.||    .:.|:||     |.|.|:
  Fly   531 GLEDRGHPKEFRAMKVGDLIQIWRFVGWMLGLA----TIVFLLELICFWRHKMWQ 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 25/145 (17%)
Lig_chan 343..585 CDD:278489 6/15 (40%)
Ir94dNP_001138099.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.