DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and si:ch211-251b21.1

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001138274.1 Gene:si:ch211-251b21.1 / 571720 ZFINID:ZDB-GENE-060809-5 Length:458 Species:Danio rerio


Alignment Length:456 Identity:97/456 - (21%)
Similarity:176/456 - (38%) Gaps:104/456 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 GLTMRATAVVTAL------PLNV-SIKEIFDFMNSKYRIQLDTYA-RLGYQARQPLRDMLDC--- 241
            ||.:.::|::..|      ||.| :|||             :.|| ..|.:......|||..   
Zfish     5 GLILVSSALLAGLCTAGPQPLKVTTIKE-------------EPYAMSKGSELEGFCIDMLSAISN 56

  Fly   242 --KFKY---IFRD----RWSDGNATGGMIGDLILDKADLAIAPFIYSFDRAL-------FLQPIT 290
              .|||   :.:|    :..|.....||||:::..:||:|:||...:..|..       |:|...
Zfish    57 KLGFKYDVHLVKDGRYGKTDDSGNWNGMIGEVVRGEADIAVAPLTLTAQREAVVDMSKPFMQTGL 121

  Fly   291 KFSVFREICMFRNPRSVSAGLSATEF---LQPFSGGVWLTFALLLLLAG-CLLWVTFILERRK-- 349
            .|.:.:::           |...::|   |:.||..:|:...:..||.. |:    |::.|..  
Zfish   122 SFIMRKDL-----------GSDDSQFLSLLKLFSTEMWMGVLVAYLLTSICI----FLVSRISPC 171

  Fly   350 QWKP--------SLLTSCLLSFGAGCIQGAWLTPRSMGGRMAFFALMVTSYLMYNYYTSIVVSKL 406
            :|:.        :|..|...:.||..:|||...|:::.||:......:.|.::...|.:.:...|
Zfish   172 EWEQPEKDNNSFTLSHSFWYTVGALTLQGAGPHPKALSGRVITSIWWIFSLVLLACYFANLSLWL 236

  Fly   407 LGQPIKSNIRTLQQLADSN-LDVGIEPTVYTRIYVETSEEPDVRDLYRKKVLGSKRSPDKIWIPT 470
            .....:.:|:|.:.||:.| ::.|......:..:.:.|..|....:|..              ..
Zfish   237 HSDNQQLSIKTFEDLANQNVIEYGTIKDSSSFNFFKNSNNPTYHRIYEH--------------IK 287

  Fly   471 EAGVLSVRDQEGF--------VYITGVATGYEFVRKHFLAHQICELNEIPLRDASHTHTVLAK-R 526
            ||...|:...|||        .:|.      |.|.......:.|.|...|.......:::.|. .
Zfish   288 EAQSYSLNAAEGFRRAQKGNYAFIG------ESVSLDLAVARYCNLTRAPEIIGMRGYSIAAPLG 346

  Fly   527 SPYAELIKLSELRMLETG-VHFKHERSWMETKLHCYQHNHTVAVGLEYAAPLFIILLGAIILCMG 590
            ||..:.:.::.||:.|:| :.:...:.|..:   |...: :....|:.|:...:.||.|..|.:|
Zfish   347 SPLIKNLSVAILRLSESGELDYFRSKWWASS---CVAKD-SKGAPLKPASLKGVFLLLAFGLGLG 407

  Fly   591 I 591
            |
Zfish   408 I 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 67/331 (20%)
Lig_chan 343..585 CDD:278489 50/262 (19%)
si:ch211-251b21.1NP_001138274.1 PBP2_iGluR_non_NMDA_like 25..375 CDD:270403 82/397 (21%)
Lig_chan 146..396 CDD:278489 52/277 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.