DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Grik

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001262788.1 Gene:Grik / 42476 FlyBaseID:FBgn0038840 Length:907 Species:Drosophila melanogaster


Alignment Length:466 Identity:103/466 - (22%)
Similarity:168/466 - (36%) Gaps:122/466 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 LTMRATAVVTAL--PLNVSIKEIFDFMNSKYRIQLDTYARLGYQARQPLRDMLDCKFKYIFRDRW 251
            |..::..|:||:  |..: :||..:.:...     |.:...|.:    |.|.|..|..:.:..|.
  Fly   409 LVNKSFVVITAISEPYGM-LKETSEKLEGN-----DQFEGFGIE----LIDELSKKLGFSYTWRL 463

  Fly   252 SDGNATG----------GMIGDLILDKADLAIAPFIYSFDRAL---FLQPITKFSVFREICMFRN 303
            .:.|..|          ||:.::|..:||:.|.....:.:|..   |..|.....:.   .:||.
  Fly   464 QEDNKYGGIDPKTGEWNGMLREIIDSRADMGITDLTMTSERESGVDFTIPFMSLGIG---ILFRK 525

  Fly   304 PRSVSAGLSATEFLQPFSGGVWLTFALLLLLAGCLLWVTFILERRK--QW--------KPSLL-- 356
            |......|.:  |:.||||.|||...|..:.....:   |:|.|..  :|        :|:.|  
  Fly   526 PMKEPPKLFS--FMSPFSGEVWLWLGLAYMGVSISM---FVLGRLSPAEWDNPYPCIEEPTELEN 585

  Fly   357 ----TSCL-LSFGAGCIQGAWLTPRSMGGRMA-----FFALMVTSYLMYNYYTSIVVSKLLGQPI 411
                .:|| .|.||...||:.|.|::...|..     ||.|::.|....|....:.|..|: .||
  Fly   586 QFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILVSSYTANLAAFLTVESLV-TPI 649

  Fly   412 ---------KSNIR--------TLQQLADSNLDVGIEPTVYTRIYVETSEEPDVRDLYRKKVLGS 459
                     |..:.        |.....:||.     || |.|:|....:.|.            
  Fly   650 NDADDLSKNKGGVNYGAKIGGATFNFFKESNY-----PT-YQRMYEFMRDNPQ------------ 696

  Fly   460 KRSPDKIWIPTEAGVLSVRDQEGFVYITGVATGYEFVRK----HFLAHQICELNEI-PLRDASHT 519
                          .::..:|||...:..  :.|.|:.:    .::..:.|.|.:: .|.|....
  Fly   697 --------------YMTNTNQEGVDRVEN--SNYAFLMESTTIEYITERRCTLTQVGALLDEKGY 745

  Fly   520 HTVLAKRSPYAELIKLSELRMLETGVHFKHERSWMETKL---HCYQHNH-TVAVGLEYAAPLFII 580
            ...:.|..||.:.:..:.|.|.|.|:..|.:..|.:.|.   .|...:. :.||.||      |.
  Fly   746 GIAMRKNWPYRDTLSQAVLEMQEQGLLTKMKTKWWQEKRGGGACSDADEDSGAVALE------IS 804

  Fly   581 LLGAIILCMGI 591
            .||.:.|.||:
  Fly   805 NLGGVFLVMGV 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 76/356 (21%)
Lig_chan 343..585 CDD:278489 62/289 (21%)
GrikNP_001262788.1 PBP1_iGluR_Kainate 37..391 CDD:107377
ANF_receptor 53..374 CDD:279440
Periplasmic_Binding_Protein_Type_2 411..781 CDD:304360 90/422 (21%)
Lig_chan 543..816 CDD:278489 69/317 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.