DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Ir87a

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:270 Identity:51/270 - (18%)
Similarity:90/270 - (33%) Gaps:94/270 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 FLQPFSGGVWLTFALLLLLAGCLLWVT-----FILERRKQWKPSLLTSCLLSFG-----AGCIQG 370
            |:..|:........:.::....::|:.     |.|.....:.|    :||...|     |...|.
  Fly   493 FVATFNADAGFLIGIFVVTCSLVVWLAQRVSGFQLRNLNGYFP----TCLRVLGILLNQAIPAQD 553

  Fly   371 AWLTPRSMGGRMAFFALMVTSYLM----YNYYTSIVVSKLLGQPIKSNIRTLQQLADSNLDVGIE 431
            ..:|.|.:      |||   |:||    .|.|.|.::|.|........|.|||::..:.:.|   
  Fly   554 FPITLRQL------FAL---SFLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTV--- 606

  Fly   432 PTVYTRIYVETSEEPDVRDLYRKKVLGSKRSPDKIWIPTEAGVLSVRDQEGFVYITGVATGYEFV 496
                    :.|||.  ||.|                           :::|.:        ::::
  Fly   607 --------MGTSEH--VRHL---------------------------NKDGEI--------FKYI 626

  Fly   497 RKHFLAHQICELNEIPLRDASHTHTVLAKRSPYAELIKLSELRMLETGVHFKHERSWMETKLHCY 561
            |:.|   |:|......|.||:..           |.|.::..|.     |..:.......:|:|:
  Fly   627 REKF---QMCYNLVDCLNDAAQN-----------EHIAVAVSRQ-----HSFYNPRIQRDRLYCF 672

  Fly   562 QHNHTVAVGL 571
            ....::.|.|
  Fly   673 DRRESLYVYL 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 47/250 (19%)
Lig_chan 343..585 CDD:278489 48/238 (20%)
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.