DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Nmdar1

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_730940.1 Gene:Nmdar1 / 40665 FlyBaseID:FBgn0010399 Length:997 Species:Drosophila melanogaster


Alignment Length:437 Identity:101/437 - (23%)
Similarity:182/437 - (41%) Gaps:95/437 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 EIFDFMNSKYRIQLDTYARLGYQARQPLRDMLDCKFKYIFRDRWSDGNATG---------GMIGD 263
            |:...:|..|.:.|....:.|:               ||.|      |.||         |:||:
  Fly   475 ELSKRINFTYDLALSPDGQFGH---------------YILR------NNTGAMTLRKEWTGLIGE 518

  Fly   264 LILDKADLAIAPFIYSFDRALFLQPITKFSVFREICMFRNPRSVSAGLSATEFLQPFSGGVWLTF 328
            |:.::||:.:||...:.:||.::: .:|...::.|.:.....|.|:.|  ..||||||..:|:  
  Fly   519 LVNERADMIVAPLTINPERAEYIE-FSKPFKYQGITILEKKPSRSSTL--VSFLQPFSNTLWI-- 578

  Fly   329 ALLLLLAGCLLWVTFILER-------------RKQWKPSLLTSC-------LLSFGAGCIQGAWL 373
             |:::....:..|.::|:|             ..:.|...|:|.       ||:.|.|  :|   
  Fly   579 -LVMVSVHVVALVLYLLDRFSPFGRFKLSHSDSNEEKALNLSSAVWFAWGVLLNSGIG--EG--- 637

  Fly   374 TPRSMGGRM-----AFFALMVTSYLMYNYYTSIVV----SKLLGQPIKSNIRTLQQLADSNLDVG 429
            ||||...|:     |.||:::.:....|....:|:    :||.|........|::.|..:.:. |
  Fly   638 TPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLSGINDARLRNTMENLTCATVK-G 701

  Fly   430 IEPTVYTRIYVETSEEPDVRDLYRKKVLGSKRSPDKIWIPTEAGVLSVRDQEGFVYITGVATGYE 494
            ....:|.|..||.|      ::||.....:       :...|..:..|:..:...:|      ::
  Fly   702 SSVDMYFRRQVELS------NMYRTMEANN-------YATAEQAIQDVKKGKLMAFI------WD 747

  Fly   495 FVRKHFLAHQICEL-NEIPLRDASHTHTVLAKRSPYAELIKLSELRMLETGVHFKHERSWM---E 555
            ..|..:.|.:.||| ....|...|.....|.|.||:.:.:.|:.|...|:|...|.::.|:   .
  Fly   748 SSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHESGFMEKLDKQWIFHGH 812

  Fly   556 TKLHCYQHNHTV-AVGLEYAAPLFIILLGAIILCMGILGLEVIWHRH 601
            .:.:|.....|. .:||:..|.:||::...|...:|::.:|||:.:|
  Fly   813 VQQNCELFEKTPNTLGLKNMAGVFILVGVGIAGGVGLIIIEVIYKKH 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 79/338 (23%)
Lig_chan 343..585 CDD:278489 60/275 (22%)
Nmdar1NP_730940.1 PBP1_iGluR_NMDA_NR1 12..405 CDD:107374
ANF_receptor 58..371 CDD:279440
PBP2_iGluR_NMDA_Nr1 417..818 CDD:270437 88/394 (22%)
HisJ 451..>558 CDD:223904 23/104 (22%)
Periplasmic_Binding_Protein_Type_2 <516..651 CDD:304360 38/145 (26%)
Lig_chan 575..838 CDD:278489 62/290 (21%)
CaM_bdg_C0 854..882 CDD:287524 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.