DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Ir8a

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_727328.1 Gene:Ir8a / 31867 FlyBaseID:FBgn0052704 Length:936 Species:Drosophila melanogaster


Alignment Length:408 Identity:87/408 - (21%)
Similarity:156/408 - (38%) Gaps:98/408 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 GMIGDLILDKADLAIAPFIYSFDRALFLQPITKFSVFREICMFRNPRSVSAGLSAT--------- 314
            |::|||:..:.|.|||             .:..:|...|:..|..|.....|:|..         
  Fly   458 GVVGDLVRGETDFAIA-------------ALKMYSEREEVIDFLPPYYEQTGISIAIRKPVRRTS 509

  Fly   315 --EFLQPFSGGVWLTFALLLLLAGCLLWV-----TFILERRKQWKP------SLLTSCLLSFGAG 366
              :|:......|||:....|:....::|.     .:.....:|..|      :|..|...:..:.
  Fly   510 LFKFMTVLRLEVWLSIVAALVGTAIMIWFMDKYSPYSSRNNRQAYPYACREFTLRESFWFALTSF 574

  Fly   367 CIQGAWLTPRSMGGRMAFFALMVTSYLMYNYYTSIVVSKLLGQPIKSNIRTLQQLA-DSNLDVGI 430
            ..||....|:::.|||...|..:...||...:|:.:.:.|..:.:::.:::|:||| .|.::..:
  Fly   575 TPQGGGEAPKAISGRMLVAAYWLFVVLMLATFTANLAAFLTVERMQTPVQSLEQLARQSRINYTV 639

  Fly   431 EPTVYTRIY---VETSEEPDVRDLYRK-KVLGSKRSPD----KIW---IPTEAG--VLSVRD--- 479
            .....|..|   ::.:|:    .|||. |.|....|.|    :||   |..:.|  :|::..   
  Fly   640 VKDSDTHQYFVNMKFAED----TLYRMWKELALNASKDFKKFRIWDYPIKEQYGHILLAINSSQP 700

  Fly   480 ----QEGFVYITGVATG-YEFVRKHFLAHQICELNEIPLRDASHTHT--VLAKRSPYAELIKLSE 537
                :|||..:...... |.|:      |...|:.....|:.:.|..  |.|:: |||..:    
  Fly   701 VADAKEGFANVDAHENADYAFI------HDSAEIKYEITRNCNLTEVGEVFAEQ-PYAVAV---- 754

  Fly   538 LRMLETGVHFKHERS-------------------WMETKL-HCYQHNHTVAVGLEYAAPLFIILL 582
                :.|.|...|.|                   |.::.| :|........:.||....:||..|
  Fly   755 ----QQGSHLGDELSYAILELQKDRFFEELKAKYWNQSNLPNCPLSEDQEGITLESLGGVFIATL 815

  Fly   583 GAIILCMGILGLEVIWHR 600
            ..::|.|..||:||::::
  Fly   816 FGLVLAMMTLGMEVLYYK 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 73/358 (20%)
Lig_chan 343..585 CDD:278489 61/291 (21%)
Ir8aNP_727328.1 PBP2_iGluR_putative 383..786 CDD:270435 73/359 (20%)
Lig_chan 520..818 CDD:278489 66/316 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.