DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and GluRIIE

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001036733.1 Gene:GluRIIE / 318623 FlyBaseID:FBgn0051201 Length:897 Species:Drosophila melanogaster


Alignment Length:447 Identity:103/447 - (23%)
Similarity:168/447 - (37%) Gaps:102/447 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 NSKYRIQLDTYARL---------GYQARQPLRDMLDCKFKYIFRDRWSDGNATG----------G 259
            |..|...::||.:|         |....:.|.|.|...|.::     :.||..|          |
  Fly   430 NKPYAQLVETYKQLEGNSQYEGYGVDLIKELADKLGFNFTFV-----NGGNDYGSYNKSTNESTG 489

  Fly   260 MIGDLILDKADLAIAPFIYSFDRALFLQPITKFSVFREICMFRNPRSVSAGLSATEFLQPFSGGV 324
            |:.:::..:|||||.....:.:|...|.....|.......::..|:..:..|..  |:.|||..|
  Fly   490 MLREIMTGRADLAITDLTITSEREQALDFTIPFMNLGIAILYLKPQKATPELFT--FMDPFSEEV 552

  Fly   325 W--LTFALLLLLAGCLLWVTFILER--RKQW--------KP-------SLLTSCLLSFGAGCIQG 370
            |  |.|:.|    |..| ..|||.|  ..:|        :|       :|..|...:.||...||
  Fly   553 WWFLGFSFL----GVSL-SFFILGRLSPSEWDNPYPCIEEPEELENQFTLGNSIWFTTGALLQQG 612

  Fly   371 AWLTPRSMGGRMA-----FFALMVTSYLMYNYYTSIVVSKLLGQPIKSNIRTLQQLADSNLDV-- 428
            :.:.|:::..|..     ||.|:|.|     .||:.:.:.|..:..:|.|.::..|||:...|  
  Fly   613 SEIGPKALSTRTVASFWWFFTLIVVS-----SYTANLAAFLTIEKPQSLINSVDDLADNKDGVVY 672

  Fly   429 GIEPTVYTRIYVETSEEPDVRDLYRKKVLGSKRSPDKIWIPTEAGVLSVRDQEGFVYITGVATGY 493
            |.:.|..||.:..||.|    :.|:|.......:|..:......||..|:....:.::. .:|..
  Fly   673 GAKKTGSTRNFFMTSAE----ERYKKMNKFMSENPQYLTEDNMEGVNRVKTNTHYAFLM-ESTSI 732

  Fly   494 EFVRKHFLAHQICELNEI-PLRDASHTHTVLAKRSPYAELIKLSELRMLETGVHFKHERSWMETK 557
            |:..|     :.|.|.:| ...|.......:.|..|:......:.|.:.|.||..|.:..|.   
  Fly   733 EYNTK-----RECNLKKIGDALDEKGYGIAMRKDWPHRGKFNNALLELQEQGVLEKMKNKWW--- 789

  Fly   558 LHCYQHNHTVAVGL-------EYAAPL---------FIILLGAIILCMGILGLEVIW 598
                   :.|..|:       ..|.||         |::|:|:   |..:|...:.|
  Fly   790 -------NEVGTGICATKEDAPDATPLDMNNLEGVFFVLLVGS---CCALLYGIISW 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 81/336 (24%)
Lig_chan 343..585 CDD:278489 64/282 (23%)
GluRIIENP_001036733.1 PBP1_iGluR_Kainate 42..396 CDD:107377
ANF_receptor 51..382 CDD:279440
PBP2_iGluR_Kainate 419..790 CDD:270432 92/396 (23%)
Lig_chan 551..824 CDD:278489 70/302 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462740
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.