DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Ir7a

DIOPT Version :10

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:230 Identity:46/230 - (20%)
Similarity:77/230 - (33%) Gaps:89/230 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 YLSELYTRSALQHRKSFTGLTMRATAVVTALPLNVS--IKEIFDFMNSKYRIQLDTYAR-LGYQA 231
            |..:|:....|.:.|              .||..:|  |:..:..:|.:|   ||.|.| |....
  Fly   421 YQGKLFDSFRLPYHK--------------PLPTEISELIRSNYTLINQEY---LDYYPRELTVLT 468

  Fly   232 RQPLRDMLDC--------KF---------KYIFRDRWSDGNATGGMIGDLILDKADLAIAPFIYS 279
            |...:|..|.        ||         :|.....||....|              .|...|:.
  Fly   469 RNGSKDRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLT--------------HIKEHIFL 519

  Fly   280 FDRALFLQ--PITKFSVFREICMFRNPRSVSAGL--------SATEFLQPFSGG----------- 323
            :...::|:  .:.||:..|:|     .:.:|||:        .|.::.:||...           
  Fly   520 YQMVIYLRRHSLLKFAFDRKI-----KQLLSAGIIGYFVREFDACQYRKPFEEDYEVTPIPLDSF 579

  Fly   324 --------VWLTFA----LLLLLAGCLLWVTFILE 346
                    :||:.|    :|.||:..::|:..|.|
  Fly   580 CGLYYISLIWLSAAVVAFILELLSQRIVWLRRIFE 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Lig_chan-Glu_bd <235..283 CDD:463166 10/64 (16%)
Periplasmic_Binding_Protein_Type_2 <259..>325 CDD:473866 13/94 (14%)
Lig_chan 343..584 CDD:459656 2/4 (50%)
Ir7aNP_572406.1 None

Return to query results.
Submit another query.