DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Ir7a

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:230 Identity:46/230 - (20%)
Similarity:77/230 - (33%) Gaps:89/230 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 YLSELYTRSALQHRKSFTGLTMRATAVVTALPLNVS--IKEIFDFMNSKYRIQLDTYAR-LGYQA 231
            |..:|:....|.:.|              .||..:|  |:..:..:|.:|   ||.|.| |....
  Fly   421 YQGKLFDSFRLPYHK--------------PLPTEISELIRSNYTLINQEY---LDYYPRELTVLT 468

  Fly   232 RQPLRDMLDC--------KF---------KYIFRDRWSDGNATGGMIGDLILDKADLAIAPFIYS 279
            |...:|..|.        ||         :|.....||....|              .|...|:.
  Fly   469 RNGSKDRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLT--------------HIKEHIFL 519

  Fly   280 FDRALFLQ--PITKFSVFREICMFRNPRSVSAGL--------SATEFLQPFSGG----------- 323
            :...::|:  .:.||:..|:|     .:.:|||:        .|.::.:||...           
  Fly   520 YQMVIYLRRHSLLKFAFDRKI-----KQLLSAGIIGYFVREFDACQYRKPFEEDYEVTPIPLDSF 579

  Fly   324 --------VWLTFA----LLLLLAGCLLWVTFILE 346
                    :||:.|    :|.||:..::|:..|.|
  Fly   580 CGLYYISLIWLSAAVVAFILELLSQRIVWLRRIFE 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 23/127 (18%)
Lig_chan 343..585 CDD:278489 2/4 (50%)
Ir7aNP_572406.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.