DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Nmdar2

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001014714.1 Gene:Nmdar2 / 31107 FlyBaseID:FBgn0053513 Length:1083 Species:Drosophila melanogaster


Alignment Length:421 Identity:79/421 - (18%)
Similarity:142/421 - (33%) Gaps:117/421 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 DCKFKYIFRDRWSDGNATGGMIGDLILDKADLAIAPFIYSFDRALFLQPITKFS-VFREICMFRN 303
            |.|:..:...:|:      |:|.||:..|.|:.:...:.:.:|    :.:..|| .|.|..:...
  Fly   589 DGKWGTLENGKWN------GLIADLVNRKTDMVLTSLMINTER----EAVVDFSEPFMETGIAIV 643

  Fly   304 PRSVSAGLSATEFLQPFSGGVWLTFALLLLLAGCLLWVTFILERRKQW-KPS-------LLTSCL 360
            ....:..:|.|.||:||....|:...::.:.|...:...|      :| .||       |..:.:
  Fly   644 VAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLF------EWLSPSGYDMKLYLQNTNV 702

  Fly   361 LSFGAGCIQGAWL-------------TPRSMGGRM-----AFFALMVTSYLMYNYYTSIVVSKLL 407
            ..:.....:..||             :||....|.     |.||::..:     .||:.:.:.::
  Fly   703 TPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLA-----IYTANLAAFMI 762

  Fly   408 GQPIKSNIRTLQQLADSNL----------DVGIEP------TV---------YTRIYVETSEEPD 447
               .:........|.||.|          ..|..|      |:         |.|.|.:||    
  Fly   763 ---TREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTS---- 820

  Fly   448 VRDLYRKKVLGSKRSPDKIWIPTEAGVLSVRDQEGFVYITG---VATGYEFVRKHFLAHQICELN 509
            |.|.....:.|:..|  .|:..|....|..:|::..:...|   ..|||..              
  Fly   821 VADGVAAVLNGNLDS--FIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGL-------------- 869

  Fly   510 EIPLRDASHTHTVLAKRSPYAELIKLSELRMLETGVHFKHERSWMETKLHC----YQHNHTVAVG 570
                        ..::.|.|.::.....|.....|...:..|.||...  |    .:|..:..:.
  Fly   870 ------------AFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGT--CRPGKQEHKSSDPLA 920

  Fly   571 LEYAAPLFIILLGAIILCMGILGLEVIWHRH 601
            ||.....|::|:..|:|...:|.||.::.::
  Fly   921 LEQFLSAFLLLMAGILLAALLLLLEHVYFKY 951

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 63/354 (18%)
Lig_chan 343..585 CDD:278489 52/299 (17%)
Nmdar2NP_001014714.1 PBP1_iGluR_NMDA_NR2 99..490 CDD:107373
PBP2_iGluR_NMDA_Nr2 502..908 CDD:270436 69/376 (18%)
Lig_chan 665..928 CDD:278489 52/310 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462785
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.