DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and glr-7

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001337310.1 Gene:glr-7 / 180547 WormBaseID:WBGene00001618 Length:885 Species:Caenorhabditis elegans


Alignment Length:433 Identity:92/433 - (21%)
Similarity:152/433 - (35%) Gaps:130/433 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 DGNATGGMIGDLILDKADLAIAPFIYSFDR-----------------ALFLQPITKFSVFREICM 300
            |.....|:||.|:...||:|:||.....:|                 .|..:...::|:|:    
 Worm   429 DNGNWNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYDLVGTTILMKKADVEYSLFK---- 489

  Fly   301 FRNPRSVSAGLSATEFLQPFSGGVWLTFALLLLLAGCLLWV-------TFI---------LERRK 349
                           |::.....|||......|....|||:       :|.         :|:|:
 Worm   490 ---------------FMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTNNKERYQNDIEKRQ 539

  Fly   350 QWKPSLLTSCLLSFGAGCIQGAWLTPRSMGGRMA------FFALMVTSYLMYNYYTSIVVSKLLG 408
            ......|..|:.|...   ||....|:::.||:.      |..:::.||.. |....:.||: |.
 Worm   540 FSLKECLWFCMTSLTP---QGGGEAPKNISGRLVAATWWLFGFIIIASYTA-NLAAFLTVSR-LE 599

  Fly   409 QPIKSNIRTLQQLADSNLDVGIEPTVYTRIYVETSE---------EPDVRDLYRKKVLGSKRSP- 463
            |||.|       |.|......||   |..|....||         |....:::::..|....|| 
 Worm   600 QPISS-------LDDLAKQYKIE---YAPIKGSASETYFRRMAEIEETFYNMWKEMSLNESMSPR 654

  Fly   464 -------------DK---IWIPTEAGVLSV----------RDQEGFVYITGVATGYEFVRKHFLA 502
                         ||   :|...:...|.|          ...:||.:| |.||..::.     |
 Worm   655 DRAKLAVWDYPVSDKFTNMWRYMQESKLPVNMDTAVDRVLNSVDGFAFI-GDATEIKYA-----A 713

  Fly   503 HQICELNEI-------PLRDASHTHTVLAKRSPYAELIKLSELRMLETGVHFKHERSWME--TKL 558
            ...|.|.::       |...|..:..:|..:...|.|:.|:| |.|||    ..|:.|.:  .|:
 Worm   714 LTNCNLQQVGTEFSRKPYAIAVQSGHILKDKISSAILMLLNE-RRLET----LKEKWWTDNPNKV 773

  Fly   559 HC-YQHNHTVAVGLEYAAPLFIILLGAIILCMGILGLEVIWHR 600
            .| ...:.:..:.::....:||::|..|.|.:..|..|..:::
 Worm   774 SCPDSSDESDGISIQNIGGVFIVILAGIALSIVTLAFEYYYYK 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 82/381 (22%)
Lig_chan 343..585 CDD:278489 66/302 (22%)
glr-7NP_001337310.1 Periplasmic_Binding_Protein_Type_1 <102..>220 CDD:324556
PBP2_iGluR_putative 373..767 CDD:270435 82/382 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.