DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Grin3b

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_579842.2 Gene:Grin3b / 170796 RGDID:621705 Length:1002 Species:Rattus norvegicus


Alignment Length:423 Identity:84/423 - (19%)
Similarity:153/423 - (36%) Gaps:153/423 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 DCKFKYIFRDRWSDGNATGGMIGDLILDKADLAIAPFIYSFDRAL---FLQPITKFSVFREICMF 301
            |.|:..:...||:      |::|||:..:|.:|:..|..:..|:.   |..|.  ||....| |.
  Rat   502 DGKYGALRDGRWT------GLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPF--FSTSLGI-MV 557

  Fly   302 RNPRSVSAGLSATEFLQPFSGGVWL-TFALLLLLAGCLLWVTFILERRKQWK-PSLLT------- 357
            |. |..::.:.|  |:.|....:|: .||.|.|.|   |::|..     :|: |..||       
  Rat   558 RT-RDTASPIGA--FMWPLHWSMWVGVFAALHLTA---LFLTLY-----EWRSPYGLTPRGRNRG 611

  Fly   358 -----SCLLSFGAGCIQGAWL---TPRSMGGRM-----AFFALMVTSYLMYNYYTSIVVSKLLGQ 409
                 |..|:.....:.|..:   ||:...||.     |.|.|:|.|     .||:.:.:.::|.
  Rat   612 TVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLS-----SYTANLAAVMVGD 671

  Fly   410 PIKSNIRTLQQLA--------------------DSNLDVGIE---------------PTVYTRIY 439
                  :|.::|:                    :|:.:..|:               ||....:.
  Rat   672 ------KTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVA 730

  Fly   440 VETSEEPDVRDLYRKKVLGSKRSPDKIWIPTEAGVLSVRDQEGFVYITGVATGY----------- 493
            :.||:.|.:......|.|    ...::.|..:..:|:|  .:.|. |.|...|.           
  Rat   731 MLTSDPPKLNAFIMDKSL----LDYEVSIDADCKLLTV--GKPFA-IEGYGIGLPQNSPLTSNLS 788

  Fly   494 EFVRKHFLAHQICELNEIPLRDASHTHTVLAKRSPYAELIKLSELRMLETGVHFKHERSWMETKL 558
            ||:.::                         |.|.:.:|:.....:|:..|     :|.:..|: 
  Rat   789 EFISRY-------------------------KSSGFIDLLHDKWYKMVPCG-----KRVFAVTE- 822

  Fly   559 HCYQHNHTVAVGLEYAAPLFIILLGAIILCMGI 591
                   |:.:|:.:.:.||      ::||:|:
  Rat   823 -------TLQMGVYHFSGLF------VLLCLGL 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 72/370 (19%)
Lig_chan 343..585 CDD:278489 50/308 (16%)
Grin3bNP_579842.2 PBP1_iGluR_NMDA_NR3 21..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 414..808 CDD:270438 73/368 (20%)
Lig_chan 576..842 CDD:278489 60/335 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 882..910
Involved in the trafficking and surface expression of NMDARs. /evidence=ECO:0000250 951..984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.