DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and Grin3b

DIOPT Version :9

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:XP_006513350.1 Gene:Grin3b / 170483 MGIID:2150393 Length:1138 Species:Mus musculus


Alignment Length:423 Identity:84/423 - (19%)
Similarity:153/423 - (36%) Gaps:153/423 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 DCKFKYIFRDRWSDGNATGGMIGDLILDKADLAIAPFIYSFDRAL---FLQPITKFSVFREICMF 301
            |.|:..:...||:      |::|||:..:|.:|:..|..:..|:.   |..|.  ||....| |.
Mouse   582 DGKYGALRDGRWT------GLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPF--FSTSLGI-MV 637

  Fly   302 RNPRSVSAGLSATEFLQPFSGGVWL-TFALLLLLAGCLLWVTFILERRKQWK-PSLLT------- 357
            |. |..::.:.|  |:.|....:|: .||.|.|.|   |::|..     :|: |..||       
Mouse   638 RT-RDTASPIGA--FMWPLHWSMWVGVFAALHLTA---LFLTLY-----EWRSPYGLTPRGRNRG 691

  Fly   358 -----SCLLSFGAGCIQGAWL---TPRSMGGRM-----AFFALMVTSYLMYNYYTSIVVSKLLGQ 409
                 |..|:.....:.|..:   ||:...||.     |.|.|:|.|     .||:.:.:.::|.
Mouse   692 TVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLS-----SYTANLAAVMVGD 751

  Fly   410 PIKSNIRTLQQLA--------------------DSNLDVGIE---------------PTVYTRIY 439
                  :|.::|:                    :|:.:..|:               ||....:.
Mouse   752 ------KTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVA 810

  Fly   440 VETSEEPDVRDLYRKKVLGSKRSPDKIWIPTEAGVLSVRDQEGFVYITGVATGY----------- 493
            :.||:.|.:......|.|    ...::.|..:..:|:|  .:.|. |.|...|.           
Mouse   811 MLTSDPPKLNAFIMDKSL----LDYEVSIDADCKLLTV--GKPFA-IEGYGIGLPQNSPLTSNLS 868

  Fly   494 EFVRKHFLAHQICELNEIPLRDASHTHTVLAKRSPYAELIKLSELRMLETGVHFKHERSWMETKL 558
            ||:.::                         |.|.:.:|:.....:|:..|     :|.:..|: 
Mouse   869 EFISRY-------------------------KSSGFIDLLHDKWYKMVPCG-----KRVFAVTE- 902

  Fly   559 HCYQHNHTVAVGLEYAAPLFIILLGAIILCMGI 591
                   |:.:|:.:.:.||      ::||:|:
Mouse   903 -------TLQMGVYHLSGLF------VLLCLGL 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 72/370 (19%)
Lig_chan 343..585 CDD:278489 50/308 (16%)
Grin3bXP_006513350.1 PBP1_iGluR_NMDA_NR3 141..481 CDD:380600
PBP2_iGluR_NMDA_Nr3 494..888 CDD:270438 73/368 (20%)
Lig_chan 656..922 CDD:365843 60/335 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.