DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75b and grik3

DIOPT Version :10

Sequence 1:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster
Sequence 2:XP_031752773.1 Gene:grik3 / 100498426 XenbaseID:XB-GENE-6050069 Length:919 Species:Xenopus tropicalis


Alignment Length:46 Identity:15/46 - (32%)
Similarity:21/46 - (45%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TSAPRAAAGGSSTLKQRKTTTTATAARNRNTGTGSGGMWRFYTDDS 66
            |||  |...||.|.|:.|......|..:|..|..|...: ||.:::
 Frog    56 TSA--AERDGSGTNKRDKQYQAHWAFGDRRNGVISARTY-FYANEA 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75bNP_001137966.2 Lig_chan-Glu_bd <235..283 CDD:463166
Periplasmic_Binding_Protein_Type_2 <259..>325 CDD:473866
Lig_chan 343..584 CDD:459656
grik3XP_031752773.1 PBP1_iGluR_Kainate 37..417 CDD:380605 15/46 (33%)
Periplasmic_Binding_Protein_Type_2 433..801 CDD:473866
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.