DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and NBP2

DIOPT Version :10

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_010446.3 Gene:NBP2 / 851740 SGDID:S000002569 Length:236 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:34/166 - (20%)
Similarity:56/166 - (33%) Gaps:60/166 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1163 VSVKSKTLANLQDGHHNNQQHHHHHHNHHSDRGQADGGSNQQDSDFDEFSSQDEDDEPQQPQQQP 1227
            :|:|....|:      :|..|:          |..||     |::.||..|...:.|        
Yeast    59 ISIKDYAYAD------SNPLHY----------GYFDG-----DNEEDEMVSDSSNGE-------- 94

  Fly  1228 QPLQSQQQQQQPLLQNPTINGQVQTQHFYQNAQELQKGQKNGSVPILGRCKALYSYTPKLYDELE 1292
               .:..::|...|.:..|..|                          |..|||.:.|:..:||.
Yeast    95 ---DTYNKRQSITLPDDYIVNQ--------------------------RAVALYDFEPENDNELR 130

  Fly  1293 LSPGDIIEVHAKQDDGWWLGALR--NHIGIFPATYV 1326
            |:.|||:.:..|...||.:....  :..|:.|..:|
Yeast   131 LAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 17/53 (32%)
NBP2NP_010446.3 SH3_Nbp2-like 114..168 CDD:212799 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.