DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and AT4G34660

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_567969.1 Gene:AT4G34660 / 829618 AraportID:AT4G34660 Length:368 Species:Arabidopsis thaliana


Alignment Length:266 Identity:51/266 - (19%)
Similarity:92/266 - (34%) Gaps:65/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1122 SNGSCTDVSSVVKP---FNRSKSNIETNFTSQPKIISTTNAAIAVSVKSKTL-ANLQDGHHNNQQ 1182
            |..:||:.:.:.:.   :.|:::.:|....:..|.:.|   .:|..:::..| |.|:|..|..|:
plant    94 SENTCTNGNVLTRAALNYGRARAQMEKERGNMLKALGT---QVAEPLRAMVLGAPLEDARHLAQR 155

  Fly  1183 HHHHHHNHHSD-----RGQADGGSNQQDSDF----------------------DEFSSQDEDDEP 1220
            :........:.     |.||....:|.:.|.                      .|.:|.....|.
plant   156 YDRMRQEAEAQATEVARRQAKARESQGNPDILMKLESAEAKLHDLKSNMTILGKEAASALASVED 220

  Fly  1221 QQPQQQPQPL----QSQQQQQQPLLQ--------------------NPTINGQVQTQHFYQNAQE 1261
            ||.:...:.|    :|::...|.:||                    .|:....:.....|:.|..
plant   221 QQQKLTLERLLSMVESERAYHQRVLQILDQLEGEMVSERQRIEAPSTPSSADSMPPPPSYEEANG 285

  Fly  1262 LQKGQKNGSVP-----ILGRCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRNHIGIF 1321
            :...|.:.:..     .||  :.|:.|......||.||.|:.:.|......||..|..:...|.|
plant   286 VFASQMHDTSTDSMGYFLG--EVLFPYHGVTDVELSLSTGEYVVVRKVTGSGWAEGECKGKAGWF 348

  Fly  1322 PATYVE 1327
            |..|:|
plant   349 PYGYIE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 16/52 (31%)
AT4G34660NP_567969.1 BAR_SH3P_plant 45..254 CDD:153291 29/162 (18%)
SH3 303..354 CDD:418401 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.