DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and Sh3kbp1

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001361630.1 Gene:Sh3kbp1 / 58194 MGIID:1889583 Length:709 Species:Mus musculus


Alignment Length:137 Identity:37/137 - (27%)
Similarity:67/137 - (48%) Gaps:16/137 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1193 DRGQADGGSNQQDSDF-DEFSSQDEDDEPQQPQQQPQPLQSQQQQQQPLLQNPTINGQVQTQHFY 1256
            |.|..:|..|.:...| |.|..:.:.|       ..:.|.|.:..::|:....:.|..:.::...
Mouse    33 DGGWWEGQINGRRGLFPDNFVREIKKD-------MKKDLLSNKAPEKPMHDVSSGNALLSSETIL 90

  Fly  1257 QNAQELQKGQKNGSVPILGRCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRNHIGIF 1321
            :..:..::.::        ||:..:||.|:..|||||..||||||..:.::|||.|.|....|:|
Mouse    91 RTNKRGERRRR--------RCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMF 147

  Fly  1322 PATYVEE 1328
            |:.:::|
Mouse   148 PSNFIKE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 24/51 (47%)
Sh3kbp1NP_001361630.1 SH3_CIN85_1 3..55 CDD:212985 7/21 (33%)
SH3_CIN85_2 102..154 CDD:212988 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..242
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..309
SH3_CIN85_3 315..370 CDD:212990
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..485
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 511..650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1577081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.