DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and si:dkey-97a13.12

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:XP_001923735.1 Gene:si:dkey-97a13.12 / 570567 ZFINID:ZDB-GENE-070912-614 Length:168 Species:Danio rerio


Alignment Length:152 Identity:35/152 - (23%)
Similarity:56/152 - (36%) Gaps:32/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 HQGPNKQAAEKELKSAEKDCVKLDNKRKKAEEAVKRADVEYYTLCVRSERARVDWEMAVLRGSAQ 887
            |||.....|..  .||:.|    :....:..|||         |.:..|.|  ||....|.|..:
Zfish    32 HQGEMMDVAAD--YSADCD----EEVSVRVGEAV---------LMLYQENA--DWCYVRLHGGKE 79

  Fly   888 ------LQSSEQQRLGNMHNFAQQYARLISDMNPILGGLSTRLQ-----PQLDACNVAKDMQVVR 941
                  ..:::|..|..|.....|.:...:|.:...||.|.||.     |.:.|.:.....:::.
Zfish    80 GYLPTACFTAKQDPLRPMVTPPAQSSVSSNDRSRCAGGRSLRLPRRASLPAVPAGSPRLLQRLLS 144

  Fly   942 HIRRNSEGPSEQLL----PDFY 959
            ..||.|:|.:.:.:    |.|:
Zfish   145 RPRRRSDGQAVRSIGSINPAFH 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342 21/90 (23%)
SH3_Nostrin 1276..1328 CDD:212757
si:dkey-97a13.12XP_001923735.1 SH3 42..86 CDD:212690 13/60 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4429
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.