DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and cd2ap

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001008583.2 Gene:cd2ap / 494040 ZFINID:ZDB-GENE-030131-8078 Length:657 Species:Danio rerio


Alignment Length:156 Identity:40/156 - (25%)
Similarity:75/156 - (48%) Gaps:30/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1193 DRGQADGGSNQQDSDF-DEFSSQDEDDEPQQPQQQPQPLQSQQQQQQPLLQ---NPTINGQVQTQ 1253
            :.|..:|..|.:...| |.|..:...|||:..::..:|.::::.:::..:|   :..:...||..
Zfish    34 EEGWMEGDLNGKRGLFPDNFVKEVRKDEPKSKEESKEPKEAKEVKEESTIQRRASGNVASLVQRI 98

  Fly  1254 HFY----------------QNAQELQKGQKNGSVPILGRCKALYSYTPKLYDELELSPGDIIEVH 1302
            ..|                .:.::|:|.|          ||.|:.|.|:..|||||..|:|||:.
Zfish    99 STYGIPAGGIGLQPHSQPRASKKKLKKRQ----------CKVLFEYVPQNEDELELKVGEIIEIT 153

  Fly  1303 AKQDDGWWLGALRNHIGIFPATYVEE 1328
            .:.::|||.|::....|:||:.:|:|
Zfish   154 EEVEEGWWSGSMNGKSGLFPSNFVKE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 22/51 (43%)
cd2apNP_001008583.2 SH3_CD2AP_1 12..58 CDD:212986 6/23 (26%)
SH3_CD2AP_2 126..180 CDD:212987 24/64 (38%)
SH3_CD2AP_3 285..341 CDD:212989
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1577081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.