powered by:
Protein Alignment Nost and cindr
DIOPT Version :9
Sequence 1: | NP_001285029.1 |
Gene: | Nost / 8673992 |
FlyBaseID: | FBgn0259734 |
Length: | 1330 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001263129.1 |
Gene: | cindr / 43654 |
FlyBaseID: | FBgn0027598 |
Length: | 941 |
Species: | Drosophila melanogaster |
Alignment Length: | 52 |
Identity: | 25/52 - (48%) |
Similarity: | 37/52 - (71%) |
Gaps: | 0/52 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1276 RCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRNHIGIFPATYVE 1327
|||.:||||....|||.|:.||:||...:.::|||.|.||:.:|:||:.:|:
Fly 97 RCKVIYSYTQVNDDELTLAVGDVIEFLGEVEEGWWRGRLRSKVGVFPSNFVQ 148
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
41 |
1.000 |
Domainoid score |
I3230 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1577081at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR14167 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.110 |
|
Return to query results.
Submit another query.