DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and cindr

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001263129.1 Gene:cindr / 43654 FlyBaseID:FBgn0027598 Length:941 Species:Drosophila melanogaster


Alignment Length:52 Identity:25/52 - (48%)
Similarity:37/52 - (71%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1276 RCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRNHIGIFPATYVE 1327
            |||.:||||....|||.|:.||:||...:.::|||.|.||:.:|:||:.:|:
  Fly    97 RCKVIYSYTQVNDDELTLAVGDVIEFLGEVEEGWWRGRLRSKVGVFPSNFVQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 25/52 (48%)
cindrNP_001263129.1 SH3_CD2AP-like_1 6..60 CDD:212806
SH3_CD2AP-like_2 97..149 CDD:212807 25/52 (48%)
SH3_CD2AP-like_3 258..310 CDD:212808
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I3230
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1577081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.