DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and Cd2ap

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_852140.2 Gene:Cd2ap / 316258 RGDID:727803 Length:637 Species:Rattus norvegicus


Alignment Length:144 Identity:41/144 - (28%)
Similarity:70/144 - (48%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1193 DRGQADGGSNQQDSDF-DEF------SSQDEDDEPQQPQQQPQPLQSQQQQQQPL-LQNPTINGQ 1249
            :.|..:|..|.:...| |.|      .::.:||.....:::|..:.|..|:.... |....|...
  Rat    34 EEGWLEGELNGRRGMFPDNFVKEIKRETEPKDDNLPIKRERPGNVASLVQRISTYGLPAGGIQPH 98

  Fly  1250 VQTQHFYQNAQELQKGQKNGSVPILGRCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGAL 1314
            .||:...:..::.|             ||.|:.|:|:..|||||:.||:|:|..:.::|||.|.|
  Rat    99 PQTKAMKKKTKKRQ-------------CKVLFEYSPQNEDELELTVGDVIDVIEEVEEGWWSGTL 150

  Fly  1315 RNHIGIFPATYVEE 1328
            .|.:|:||:.:|:|
  Rat   151 NNKLGLFPSNFVKE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 24/51 (47%)
Cd2apNP_852140.2 Interaction with ANLN and localization to the midbody. /evidence=ECO:0000250 1..175 41/144 (28%)
SH3_CD2AP_1 3..58 CDD:212986 6/23 (26%)
SH3_CD2AP_2 111..165 CDD:212987 26/67 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..211
SH3_CD2AP_3 271..327 CDD:212989
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..455
SH3-binding. /evidence=ECO:0000255 336..352
SH3-binding. /evidence=ECO:0000255 378..397
SH3-binding. /evidence=ECO:0000255 410..422
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..556
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1577081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.