DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and Pstpip1

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001100294.2 Gene:Pstpip1 / 300732 RGDID:1307557 Length:416 Species:Rattus norvegicus


Alignment Length:676 Identity:121/676 - (17%)
Similarity:190/676 - (28%) Gaps:273/676 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   660 RFKD-------EGQNGFEELRRYVKQGGDFSKELIFVLQERADSELIYSKSLSKLANKLNKAGRE 717
            :|:|       ....|:|.|.:.:..|....|::..:|::||.:|..|.|.|.::|.|  ..|:.
  Rat     6 QFRDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDVEELLRQRAQAEERYGKELVQIARK--AGGQT 68

  Fly   718 IPGSVADAWRGVATEMESRSDIHRQLAASLTDELVKPLKIVVEGHHKARKAVESNVDKAARVLGE 782
            ...|:..::..:..:.|:....|.|||.:|.:|| :.|:...|...:.||..|:.:|:.      
  Rat    69 EMNSLRTSFDSLKQQTENVGSAHIQLALALREEL-RSLEEFRERQKEQRKKYEAVMDRV------ 126

  Fly   783 WRASEAKAKKASHTAARENEKLQDAMLDVRIQKSPSIALLHQGPNKQAAEKELKSAEKDCVKLDN 847
                 .|:|.:.:....|::|..|       ||........|...:.:|....|..||.    ..
  Rat   127 -----QKSKLSLYKKTMESKKSYD-------QKCRDADDAEQAFERVSASGHQKQIEKS----QT 175

  Fly   848 KRKKAEEAVKRADVEYYTLCVRSERARVDWEMAVLRGSAQLQSSEQQRLGNMHNFAQQYARLISD 912
            |.|:.:|:...||..|.....:.|:||.:||..........|..|..||..:.|....:...:| 
  Rat   176 KAKQCKESATEADRVYRQNIEQLEKARTEWEQEHRTTCEAFQLQEFDRLTILRNALWVHCNQLS- 239

  Fly   913 MNPILGGLSTRLQPQLDACNVAKDMQVVRHIRRNSEGPSEQLLPDFYCEHTTLAMNRERRKHALI 977
                                                                             
  Rat   240 ----------------------------------------------------------------- 239

  Fly   978 KLLQLVKTDLERERRSRDGLRGLSQSLNHQEHQNITDKLYHIRSMLTYLEGARLKLHSALLELDH 1042
              :|.||                            .|:||         |..||.|....:|   
  Rat   240 --MQCVK----------------------------DDELY---------EEVRLTLEGCDVE--- 262

  Fly  1043 KPRATHPLAQHIHITRDRTGLQQSILKVPNWLKNNDKSQTQQSTSMLAHDITDITTNHEDELPDE 1107
                           .|..|..||            ||                 |..|...|  
  Rat   263 ---------------GDINGFIQS------------KS-----------------TGREPPAP-- 281

  Fly  1108 NCSHLHSSSHSNNNSNGSCTDVSSVVKPFNRSKSNIETNFTSQPKIISTTNAAIAVSVKSKTLAN 1172
                                      .|:........|..|..| |:.|:...|      |..:.
  Rat   282 --------------------------VPYQNYYDREVTPLTGSP-IVQTSCGVI------KRFSG 313

  Fly  1173 LQDGHHNNQQHHHHHHNHHSDRGQADGGSNQQDSDFDEFSSQDEDDEPQQPQQQPQPLQSQQQQQ 1237
            |..|                                     ..:....|.|....:.|....:|:
  Rat   314 LLHG-------------------------------------SPKTTPSQAPAASTETLAPTSEQK 341

  Fly  1238 QPLLQNPTINGQVQTQHFYQNAQELQKGQKNGSVPILGRCKALYSYTPKLYDELELSPGDIIEVH 1302
            :  |...:|..|....:....||:.               :|||.||.:..|||::|.|||:.|.
  Rat   342 E--LVYASIEVQATQGNLNSAAQDY---------------RALYDYTAQNSDELDISAGDILAVI 389

  Fly  1303 AKQDDGWWLGALRNHIGIFPATYVEE 1328
            .:.:||||........|..|.:|:|:
  Rat   390 LEGEDGWWTVERNGQRGFVPGSYLEK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342 59/251 (24%)
SH3_Nostrin 1276..1328 CDD:212757 20/51 (39%)
Pstpip1NP_001100294.2 BAR 16..257 CDD:299863 68/370 (18%)
SH3_PSTPIP1 363..415 CDD:212758 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.