DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and SPBC119.05c

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_595286.1 Gene:SPBC119.05c / 2539945 PomBaseID:SPBC119.05c Length:296 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:42/205 - (20%)
Similarity:68/205 - (33%) Gaps:77/205 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1130 SSVVKPFNRSKSNIETNFTSQPKIISTTNAAIAVSVKSKTLANLQDGHHNNQQHHHHHHNHHSDR 1194
            |||..|..:.||::|....|    :::..||:::|..|                           
pombe    59 SSVPLPLPKRKSSVEKRAGS----VASAVAAMSLSQNS--------------------------- 92

  Fly  1195 GQADGGSNQQDSDFDEFSSQDEDDEPQQPQQQPQPLQSQQQQQ--------QPLLQNPTINGQVQ 1251
                                .|...|::|::.|.....|:|.:        :.|...|:..|. .
pombe    93 --------------------GEKRTPEEPRKLPGVPAPQKQSEASSVNSSTEKLPPPPSYPGP-N 136

  Fly  1252 TQHFYQNAQELQKGQKNGSVPILGRCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRN 1316
            |.|            ||     :.|..|:|.:......:|....|::|.|....::.||.|.|..
pombe   137 TAH------------KN-----VERVLAMYDFPGPDAGDLGFHAGEVIIVLEHVNNDWWRGELNG 184

  Fly  1317 HIGIFPATYV 1326
            ..||||:.||
pombe   185 KEGIFPSNYV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 17/51 (33%)
SPBC119.05cNP_595286.1 SH3 142..195 CDD:214620 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.