DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and cdap-2

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_491143.3 Gene:cdap-2 / 171906 WormBaseID:WBGene00021549 Length:551 Species:Caenorhabditis elegans


Alignment Length:50 Identity:20/50 - (40%)
Similarity:31/50 - (62%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1279 ALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRN--HIGIFPATYV 1326
            |.|:|:.|..|||....||:||:.:..:|||..|.|::  .:|:||..:|
 Worm    53 ATYAYSSKQDDELSFVVGDLIELISDVEDGWSKGKLKSTGAVGMFPTNFV 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 19/49 (39%)
cdap-2NP_491143.3 SH3 53..104 CDD:302595 19/49 (39%)
SH3 194..249 CDD:302595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1577081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.