powered by:
Protein Alignment Nost and cdap-2
DIOPT Version :9
Sequence 1: | NP_001285029.1 |
Gene: | Nost / 8673992 |
FlyBaseID: | FBgn0259734 |
Length: | 1330 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491143.3 |
Gene: | cdap-2 / 171906 |
WormBaseID: | WBGene00021549 |
Length: | 551 |
Species: | Caenorhabditis elegans |
Alignment Length: | 50 |
Identity: | 20/50 - (40%) |
Similarity: | 31/50 - (62%) |
Gaps: | 2/50 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1279 ALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRN--HIGIFPATYV 1326
|.|:|:.|..|||....||:||:.:..:|||..|.|:: .:|:||..:|
Worm 53 ATYAYSSKQDDELSFVVGDLIELISDVEDGWSKGKLKSTGAVGMFPTNFV 102
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1577081at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR14167 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.110 |
|
Return to query results.
Submit another query.