DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and sh3kbp1

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:XP_002935234.3 Gene:sh3kbp1 / 100151706 XenbaseID:XB-GENE-492559 Length:655 Species:Xenopus tropicalis


Alignment Length:122 Identity:33/122 - (27%)
Similarity:60/122 - (49%) Gaps:19/122 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1209 DEFSSQDEDDEPQQPQQQP--QPLQSQQQQQQPLLQNPTINGQVQTQHFYQNAQELQKGQKNGSV 1271
            |.|..:.:.|..::...:|  :|.|.        :.|.  |..:.::...::|...::.::.   
 Frog    50 DNFVRELKKDTKKEQNSKPPDRPTQG--------ISNG--NALLSSEAVIRSAGRGERTRRR--- 101

  Fly  1272 PILGRCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRNHIGIFPATYVEE 1328
                ||:..:||.|:..|||||..|:||||..:.::|||.|.|....|:||:.::.|
 Frog   102 ----RCQVAFSYLPQNEDELELKVGEIIEVLGEVEEGWWEGVLNGKTGMFPSNFIRE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 23/51 (45%)
sh3kbp1XP_002935234.3 SH3_CIN85_1 3..55 CDD:212985 2/4 (50%)
SH3_CIN85_2 103..154 CDD:212988 22/50 (44%)
SH3_CIN85_3 264..319 CDD:212990
PHA03247 <356..595 CDD:223021
Spc7 <586..>655 CDD:197874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1577081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.