DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nost and sh3d21

DIOPT Version :9

Sequence 1:NP_001285029.1 Gene:Nost / 8673992 FlyBaseID:FBgn0259734 Length:1330 Species:Drosophila melanogaster
Sequence 2:XP_004911622.2 Gene:sh3d21 / 100145355 XenbaseID:XB-GENE-5889544 Length:552 Species:Xenopus tropicalis


Alignment Length:179 Identity:40/179 - (22%)
Similarity:76/179 - (42%) Gaps:27/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1152 KIISTTNAAIAVSVKSKTLANLQDGHHNNQQHHHHHHNHHSDRGQADGGSNQQDSDFDEFSSQDE 1216
            |..|.....::|....:.|..::||....:            :|:|.|.          |.|...
 Frog   120 KASSADELELSVGEVFQVLEEIEDGWWLGK------------KGEAVGA----------FPSNFV 162

  Fly  1217 DDEPQQPQQQPQPLQSQQQQQQPLLQNPTINGQVQTQHFYQNAQELQKGQKNGSVPILGR--CKA 1279
            .:.|:.|.:: .|..|:..:::|.:.:...:.:.:.:...::....:...|..|.|...:  |:.
 Frog   163 KEVPEPPSEK-IPELSKNAKKRPAMMDINFSAKEEEKSKQEDKSVPENQSKEDSSPPHAKEYCRV 226

  Fly  1280 LYSYTPKLYDELELSPGDIIEVHAKQ--DDGWWLGALRNHIGIFPATYV 1326
            ::.|.|.|.|||.|..||:|.:.:|:  |:|||.|......|:||..:|
 Frog   227 MFDYKPFLPDELALKKGDVILLISKETGDEGWWQGEHNGKTGLFPDNFV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NostNP_001285029.1 F-BAR_NOSTRIN 663..908 CDD:153342
SH3_Nostrin 1276..1328 CDD:212757 21/55 (38%)
sh3d21XP_004911622.2 SH3 6..59 CDD:418401
SH3_CD2AP-like_2 112..164 CDD:212807 11/65 (17%)
SH3_D21-like 223..277 CDD:213018 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1577081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.