DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24Bc and CG42465

DIOPT Version :10

Sequence 1:NP_001162862.1 Gene:Sfp24Bc / 8673990 FlyBaseID:FBgn0261054 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster


Alignment Length:76 Identity:20/76 - (26%)
Similarity:43/76 - (56%) Gaps:5/76 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQYFVILFAIISFLALAHGKKDPMCRNKPFAVGKCQQIVTGYTFAPKKKRCSRFSAEGCRVTGNF 65
            |:.:::::.|::..|..:|.   :|..:||..|.|.::...|::...|..|..:  :||.:.||.
  Fly     1 MKVYILIWTILALTADINGL---VCNLEPFVQGSCLELTDLYSYVEYKNDCVYW--QGCLLNGNH 60

  Fly    66 FNTRQQCEEKC 76
            |:.:::||:.|
  Fly    61 FSKKEECEDMC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24BcNP_001162862.1 KU 27..76 CDD:197529 14/48 (29%)
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 15/51 (29%)

Return to query results.
Submit another query.