DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24Bc and Sfp24Ba

DIOPT Version :10

Sequence 1:NP_001162862.1 Gene:Sfp24Bc / 8673990 FlyBaseID:FBgn0261054 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001162859.1 Gene:Sfp24Ba / 8673984 FlyBaseID:FBgn0259951 Length:121 Species:Drosophila melanogaster


Alignment Length:101 Identity:36/101 - (35%)
Similarity:55/101 - (54%) Gaps:19/101 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILFAIISFLALAHGKKDPMCRNKPFAVGKCQQIVTGYTFAPKKKRCSRFSAEGCRVTGNFFNT 68
            ||::..:||:: ||....|  |.|||...|.|.||:.|:|||.::.||.:|.|:||.|.||:|..
  Fly     5 FVVITFLISYV-LAQSNAD--CGNKPIVDGNCDQIIKGFTFATEENRCKKFRAKGCTVGGNYFRA 66

  Fly    69 RQQCEEKC---------------WDEYQDLVEFQKN 89
            :.:||.||               |:| .::.::..|
  Fly    67 KDECELKCKGYINWGIESFGNGDWEE-SEIEDYWNN 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24BcNP_001162862.1 KU 27..76 CDD:197529 23/48 (48%)
Sfp24BaNP_001162859.1 Kunitz-type 18..74 CDD:444694 25/57 (44%)

Return to query results.
Submit another query.