DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24Bc and COL28A1

DIOPT Version :10

Sequence 1:NP_001162862.1 Gene:Sfp24Bc / 8673990 FlyBaseID:FBgn0261054 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001032852.2 Gene:COL28A1 / 340267 HGNCID:22442 Length:1125 Species:Homo sapiens


Alignment Length:60 Identity:21/60 - (35%)
Similarity:32/60 - (53%) Gaps:5/60 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GKKDPMCRN--KPFAVGKCQQIVTGYTFAPKKKRCSRFSAEGCRVTGNFFNTRQQCEEKC 76
            |.:||.|..  ||   |.|.:.|..:.:..:...|:||...||..:||.||:.::|:|.|
Human  1066 GAEDPRCLEALKP---GNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQETC 1122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24BcNP_001162862.1 KU 27..76 CDD:197529 16/50 (32%)
COL28A1NP_001032852.2 vWFA_subfamily_ECM 47..209 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..769
gly_rich_SclB <272..>582 CDD:468478
gly_rich_SclB <478..>759 CDD:468478
VWA 798..974 CDD:459670
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1066 21/60 (35%)
Kunitz-type 1072..1122 CDD:444694 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.