DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24Bc and Col28a1

DIOPT Version :10

Sequence 1:NP_001162862.1 Gene:Sfp24Bc / 8673990 FlyBaseID:FBgn0261054 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001418648.1 Gene:Col28a1 / 312115 RGDID:1564680 Length:1141 Species:Rattus norvegicus


Alignment Length:58 Identity:20/58 - (34%)
Similarity:30/58 - (51%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KDPMCRN--KPFAVGKCQQIVTGYTFAPKKKRCSRFSAEGCRVTGNFFNTRQQCEEKC 76
            |||.|..  ||   |.|...|..:.:..:...|:||...||..:||.|::.::|:|.|
  Rat  1084 KDPRCEEALKP---GNCGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECQETC 1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24BcNP_001162862.1 KU 27..76 CDD:197529 15/50 (30%)
Col28a1NP_001418648.1 vWFA_subfamily_ECM 47..212 CDD:238727
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
Collagen 713..772 CDD:460189
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.