DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and CG42537

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster


Alignment Length:88 Identity:45/88 - (51%)
Similarity:58/88 - (65%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLLIMACLTLYVA-SINAQICQGRPVFQL-CTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRC 63
            ||.||::||:.|||: :.....|.|||..:| |.||::|| ..||.|..||.:.||:||.|:|:|
  Fly     1 MKLLLVLACVVLYVSLACGQNRCDGRPRGRLSCEGGKNEG-FGGRHCRRTAMDEMWYYNQRTRKC 64

  Fly    64 EKMNYRGCGGNGNRYCKVEDCNR 86
            .||.|.|||||.||||.:..|.|
  Fly    65 LKMKYLGCGGNQNRYCSLRHCQR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 20/32 (63%)
CG42537NP_001163530.1 Kunitz-type 33..89 CDD:444694 31/56 (55%)

Return to query results.
Submit another query.