DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and TFPI2

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens


Alignment Length:65 Identity:22/65 - (33%)
Similarity:31/65 - (47%) Gaps:7/65 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDCNR 86
            |..:.:...|...:|||     .|  :|....:::|.|.|.|:...|.|||||.|.:...|||.|
Human   149 CAPKKIPSFCYSPKDEG-----LC--SANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKR 206

  Fly    87  86
            Human   207  206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/32 (44%)
TFPI2NP_006519.1 Kunitz_TFPI2_1-like 32..88 CDD:438659
Kunitz_BPTI 95..149 CDD:425421 22/65 (34%)
Kunitz_TFPI1_TFPI2_3-like 155..204 CDD:438658 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.